SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001991 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001991
Domain Number 1 Region: 190-334
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-38
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.72e-26
Family First domain of FERM 0.00056
Further Details:      
 
Domain Number 3 Region: 77-192
Classification Level Classification E-value
Superfamily Second domain of FERM 1.13e-19
Family Second domain of FERM 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001991   Gene: ENSMPUG00000002010   Transcript: ENSMPUT00000002032
Sequence length 569
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897087.1:38488:360766:-1 gene:ENSMPUG00000002010 transcript:ENSMPUT00000002032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEKDYFGIRYVDPEKQRHWLEPNK
SISKQMKSHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYL
GACIVQDELSDYYIKDPLEHPKNQTPEKLIYPRPLQNLTKAAIELHKCDSRGQSPPVAEF
NLLLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEG
KTFYVIGIQKEKKAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKG
SRFRYSGKVAKEVVEASSKIQREPPEVHRTSMTQSRSSYSLNKQLIINMEPLKPLLPSPN
EQEEELLLGEGVPLPKEDVSAPLISSSPVKEAREYENPPNEEEEDKIKEEPLTISELAYN
PSASLLPTPVDDDEIDMLFDCTSRLELEREDTDSFEELEADEHAFLMAEEEELKEAHQAL
SWSYDILRGHIRVNPLVKSFSRLLVVGLGLLLFVFPLLLLLLESGIDLSFLCEIRQTPEF
EQFHYEYYCPLKEWLAGKVNLILYMLGCS
Download sequence
Identical sequences M3XSE1
ENSMPUP00000001991 ENSMPUP00000001991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]