SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002070 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002070
Domain Number 1 Region: 887-971
Classification Level Classification E-value
Superfamily DEATH domain 5.49e-24
Family DEATH domain, DD 0.0000516
Further Details:      
 
Domain Number 2 Region: 195-287
Classification Level Classification E-value
Superfamily Immunoglobulin 3.5e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 286-337
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000445
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 340-394
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 5 Region: 89-191
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000196
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002070   Gene: ENSMPUG00000002091   Transcript: ENSMPUT00000002113
Sequence length 977
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896950.1:3090509:3368269:1 gene:ENSMPUG00000002091 transcript:ENSMPUT00000002113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSQVERGCDFTSSITGLVRILRLHLICPLRLMSSLVAAPGHTREEKNTGFELCHSMPKV
DLHHKRPRDDDFFHELPETFPSDPPEPLPHFLIEPEEAYIVKNKPVNLYCKASPATQIYF
KCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSAGTT
KSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVED
RNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCN
SRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTCGTECT
HWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQSFLYPISTEQRTQNEYGFSSAPDS
DDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQD
LLVVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDL
SEFASKLSPQMTQSLLENEALNVKNQSLARQTDPSCTAFGTFNSLGGHLIVPNSGVSLLI
PAGAIPQGRVYEMYVTVHRKENMRPPMEDTQTLLTPVVSCGPPGALLTRPVILTMHHCAD
PNTEDWKIQLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHLLTENLSTYALVGQST
TKAAAKRLKLAIFGPLCCSSLEYSVRVYCLDDTQDALKEVLQLERQIGGQLLEEPKALHF
KGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERFSLNTVELV
CKLCVRQVEGEGQIFQLHCTVSEEPTGIDLPLLDPASTITTMTGPGAFSIPPPIRQKLCS
SLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLE
EMGRHETVVSLAAEGQY
Download sequence
Identical sequences M3XSM0
ENSMPUP00000002070 ENSMPUP00000002070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]