SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002204 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002204
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.99e-22
Family Ribosomal protein L24e 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002204   Gene: ENSMPUG00000002228   Transcript: ENSMPUT00000002250
Sequence length 163
Comment pep:known scaffold:MusPutFur1.0:GL897192.1:1411578:1426421:1 gene:ENSMPUG00000002228 transcript:ENSMPUT00000002250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG
KELTVDNSFEFEKRRNEPVKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK
VQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQKLQQDVDMEDVS
Download sequence
Identical sequences G9KM04 U6CQB9
XP_004687831.1.23501 XP_004779290.1.14098 ENSMPUP00000002204 ENSMPUP00000002204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]