SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002354 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002354
Domain Number 1 Region: 10-142
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.8e-29
Family Cyclophilin (peptidylprolyl isomerase) 0.0000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002354   Gene: ENSMPUG00000002381   Transcript: ENSMPUT00000002403
Sequence length 147
Comment pep:novel scaffold:MusPutFur1.0:GL897336.1:884:1373:-1 gene:ENSMPUG00000002381 transcript:ENSMPUT00000002403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHGQPYALGYCMEEESLGYVSFMLFADKVSKTAEFHTLSSGKKIILRFMCQNGDFTSKST
YGEKFGDENFILKKFGGSTKVLANAGPNKNVSHLAVYTVKTEWLDGKHEVFGKVKEGMNT
VEAIELFGSRDGKTSGKITIADKSNKF
Download sequence
Identical sequences M3XTF4
ENSMPUP00000002354 ENSMPUP00000002354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]