SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002439 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002439
Domain Number 1 Region: 131-369
Classification Level Classification E-value
Superfamily Caspase-like 3.59e-59
Family Caspase catalytic domain 0.0000374
Further Details:      
 
Domain Number 2 Region: 30-110
Classification Level Classification E-value
Superfamily DEATH domain 0.00000141
Family Pyrin domain, PYD 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002439   Gene: ENSMPUG00000002467   Transcript: ENSMPUT00000002490
Sequence length 369
Comment pep:known scaffold:MusPutFur1.0:GL896969.1:129454:156013:-1 gene:ENSMPUG00000002467 transcript:ENSMPUT00000002490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGLESCGRSESNGLRAPPITAAVDLQSRVQETLDLLSPQELSYFRIFLKSVDEEPRVT
PLWLELAGNSKERLAGLLVQHYCEPASASRVLVKVLQQLRRADLLRRWQGAGDADDREIP
RKIPKRSYDCVDGELDCYDLRGKRKAFVMCVEKNRPGAHRDICLMEEWLGQCRFEHTQCI
DPNKMELIEKIRSFRDGLNESKDDVGCCLVTLMSHGEKGFIKMEDGEKVSLEDIFEMFNN
KNCPALQEKPKIFIIQACRGEKRDSGVETDDEPMESDDVAEKRRLPTFSDYFIIYPTQAD
HVALRHPRTGSVMIEAMSAVFKQYGNKWHIADFFTKVNNRVVHTEFHLHEEPIKVSLVME
STLTRFVYF
Download sequence
Identical sequences M3XTN9
ENSMPUP00000002439 XP_004759363.1.14098 ENSMPUP00000002439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]