SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002444 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002444
Domain Number 1 Region: 29-160
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.34e-40
Family Cyclophilin (peptidylprolyl isomerase) 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002444   Gene: ENSMPUG00000002472   Transcript: ENSMPUT00000002495
Sequence length 161
Comment pep:novel scaffold:MusPutFur1.0:GL896947.1:550945:551582:-1 gene:ENSMPUG00000002472 transcript:ENSMPUT00000002495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPRLKFPLTLIYSGNRKATLYKVCISSLAENFRALSTGEKGLGYKVSCFHRIIPGFLC
QGGDLICHHSTGGRSIYGNKVDVEDFILKHKGLGILLVANAGPNPNSSRFLICTAKTEWL
AGWHAVFGKVRKGMNIGSMDGFGSRNGKTSEKITTSDCRQT
Download sequence
Identical sequences M3XTP4
ENSMPUP00000002444 ENSMPUP00000002444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]