SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002600 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002600
Domain Number 1 Region: 415-565
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-50
Family MATH domain 0.0000000357
Further Details:      
 
Domain Number 2 Region: 365-414
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 9.68e-21
Family Trimerization domain of TRAF 0.0000931
Further Details:      
 
Domain Number 3 Region: 113-212
Classification Level Classification E-value
Superfamily TRAF domain-like 1.9e-16
Family SIAH, seven in absentia homolog 0.013
Further Details:      
 
Domain Number 4 Region: 44-99
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000972
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 5 Region: 213-254
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000017
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002600
Domain Number - Region: 271-411
Classification Level Classification E-value
Superfamily Tropomyosin 0.00301
Family Tropomyosin 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002600   Gene: ENSMPUG00000002628   Transcript: ENSMPUT00000002654
Sequence length 569
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896944.1:1653765:1766195:-1 gene:ENSMPUG00000002628 transcript:ENSMPUT00000002654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSKKLDPPGTLPPNPPLKLHPDRGATSTSVFVPEQGGYKERFVKTVEDKYKCEKCRLV
LCNPKQTECGHRFCETCMAALLSSSSPKCTACQEGIIKDKVFKDNCCKREILALQIYCRN
EGEGCTEQLTLGHLLVHLKNDCQFEELSCVRADCKEKVLRRDLRDHVEKACKYREATCGH
CKSPVPLVTLQKHEDTECPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGC
VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFE
IEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQSWEEADSVKSSVESLQN
RVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLI
WKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMR
GEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVA
QTVLENGTYIKDDTIFIKVIVDTSDLPDP
Download sequence
Identical sequences M3XU50
ENSMPUP00000002600 ENSMPUP00000002600 XP_004754710.1.14098 XP_004754711.1.14098 XP_004754712.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]