SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002681 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002681
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-24
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-22
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 474-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 157-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002681   Gene: ENSMPUG00000002709   Transcript: ENSMPUT00000002736
Sequence length 531
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897208.1:1129846:1140663:1 gene:ENSMPUG00000002709 transcript:ENSMPUT00000002736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCILFQELLSFKDISMEFTWEEWQLLDSTQKYLYRDVILENYSHLVSLGYHGTKPDLIF
KLEQGEEPWIINARVSRPSCPEGWKEWGQENEDEFEYVERSFACAAFGRRRLSRTRVPSG
QRIHKYSTHGRRLTQSSASAKSCLRKNPDKFHGYEESYFLKHQRAHSIEKNCVCNECGKA
FRCRSQLIVHLRIHTGERPYECTKCERAFSAKSNLNAHQRVHTGEKPYSCGECGKVFSFR
SQLIVHQEVHTGGKPYGCSECGKAYSWKSQLLLHQRSHTGVKPYECGECGKAFSLKSPFV
VHQRTHTGVKPHKCSECGKAFRSKSYLLVHIRMHTGEKPYQCSDCGKAFNMKTQLVVHQG
IHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCGECGKAFSSKSYLVIHRRTHTG
ERPYECSFCERAFCGKSQLIIHQRTHSTEKPYECSECEKAYPRKASLQIHQKTHSGEKPF
KCGECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
Download sequence
Identical sequences M3XUD1
ENSMPUP00000002681 ENSMPUP00000002681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]