SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002747 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002747
Domain Number 1 Region: 39-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.74e-36
Family SCAN domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 409-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.28e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 744-801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 801-857
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.75e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 913-969
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 632-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 857-913
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 465-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 214-271
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-20
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 11 Region: 576-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 689-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 13 Region: 368-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 954-1003
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000509
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002747   Gene: ENSMPUG00000002775   Transcript: ENSMPUT00000002805
Sequence length 1036
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897294.1:70997:104925:-1 gene:ENSMPUG00000002775 transcript:ENSMPUT00000002805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTMTRENWAHSALRQEGLVKGKDDTWKWGTSFQGSNSSVWETSHLHFRQLRYHETSGPH
EALSRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQIHRPGSGEEAVALV
EELQKDLDGPALKVPVLVQDQDLLQEGMSTPGTAVPHAPISSHIATEICQNPFTDAVMFN
LQDPQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWECLGPI
QRALYWDVMLENYGNVTSLEWETMTENEEVTPKPSISQRADSQKGTSKRLQGGVPQNLDF
EEACEWQVLASHWGTKTGEIDTLKKVSVCERDKKKRTLPEMQGQKWKEFGESLTSGSALS
ESLIGTEGKKFYKCDICCKHFSKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLR
NHSGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSG
ERPYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPY
KCDECGKTFAQTTYLVDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKK
CGKNFNSKSNLIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKV
FILKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMS
KSFMVHQKLHTQEKSYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLI
EHKRIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCSDCGKVFSYRSNLIAHQR
IHTGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTG
EKPYKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPY
GCNDCSKVFRQRKNLTVHQKIHTDGKLCECDESEKEFSQTSNLPLQQEIHTVKEFSWFQN
ANESKRDPETLMSFVK
Download sequence
Identical sequences M3XUJ7
ENSMPUP00000002747 ENSMPUP00000002747 XP_012905936.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]