SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002770 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002770
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-26
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 2 Region: 464-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.31e-25
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 408-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.54e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 579-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 520-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.72e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.39e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 673-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 631-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 240-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.53e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 11 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002770   Gene: ENSMPUG00000002799   Transcript: ENSMPUT00000002829
Sequence length 730
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897345.1:289317:297798:1 gene:ENSMPUG00000002799 transcript:ENSMPUT00000002829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMIQAQEFLTFDDVAVDFTWEEWQLLAPAQKDLYRDMMLENYRNLVSVGYHASKPDALSK
LERGEFWTREDEMHSQICPEIRNVDDSLQRHLENRSNQKSVEQWCEHNTFANILNQSESH
FLLKQKYDIFDLCEKPSKSNLSFESRSINYNSRHSEFNEDVKSCLHTNHEQFYSVIKFPV
SVKPINSNSQVIKQQRIHNMQKAHVCGDCGKAFVKVSQLIDHQRVHTQEKPHGCSLCGKA
FSRKSRLTEHQRTHTGLKHQCTECDKTFFKKSQFILHQKTHTGQKPYTCNECGKVFIKKC
QLIYHQRTHTGEKPHACSLCEKAFSTKFSLTTHQKTHTGEKPYICCDCGKGFIEKRRLVA
HQRTHTGEKPFICNECGKGFTLKNSLITHQQTHTEQKLYMCSECGKGFSVKHCLIVHQRS
HTGEKPYTCSECGKGFTLKSPLIRHQRTHTGEKPYVCSVCGKGFTMKSDLIVHQRTHTAE
KPYICNDCGKAFTVKNRLIVHQRTHTGEKPYICSECGKGFPAKIRLIGHQRTHTGEKPYI
CNECGKGFTEKSHLNVHRRTHTGEKPYICNECGKGLTGKSMLIAHLRTHTGEKPYICNEC
GKGFTMKSTLGIHQQTHTGEKPYKCNECDKAFRKKTCLVQHQRFHTGKTSFACPECGKYS
LRKNDLITHQRIHTGEKPYECSECGKAFTTKSGLNVHQRKHTGERPYGCSDCGKAFAHLS
ILVKHKRIHS
Download sequence
Identical sequences M3XUM0
ENSMPUP00000002770 ENSMPUP00000002770 XP_004781965.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]