SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002985 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002985
Domain Number 1 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-25
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 2 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 492-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 35-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 155-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 535-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000222
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 9 Region: 454-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000572
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 258-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000193
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002985   Gene: ENSMPUG00000003015   Transcript: ENSMPUT00000003046
Sequence length 580
Comment pep:novel scaffold:MusPutFur1.0:GL897021.1:6203237:6211605:1 gene:ENSMPUG00000003015 transcript:ENSMPUT00000003046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSLPEASLWGHPPEEQPQEPLTILSALISSKDQESVTFKDVAIDLTQEEWTLMDRSQR
KLYIDVMLENITHLVSVGCQFFQADVISQWEQGGELWREDRGLAQGWNPGLENSYKKEET
ISMQDIFKEDPSDCGIIPKYHPGENPFEHIGYDEVFSQTYTLTQHVLTHTGPRPYKWSEC
GKHFSHRSDLYRHQKTFMEAKPYKCNQCDKCFHNRRKLCIHQRIHTGEKPYKCDECGKNF
SRNSHLRSHKITHTGENPFVCNQCGSHFRYFSSLTRHKHIHSGQKPYECHLCGKAFVQSS
YLKQHERTHTGEKPYKCLLCGKAFVTSSNLREHERTHTGEKPYKCHLCGKAFVQSSCFRQ
HERTHTGEKPYKCRLCGKAFITSSCLKKHERTHTGEKPYKCLLCGKAFVTSSNLREHERT
HTGEKPYKCPLCEKAFVTSSNLREHERTHTGEKPYKCHLCGKAFVTSSCLREHERTHTGE
KPYKCPLCGKGFVTSSCLRKHERTHTGEKPYKCPLCGKAFVTSSNLREHERTHSGESPYK
CPLCGKAFVESSKELERTHTGENPYKCPLCGKAFVTSSCL
Download sequence
Identical sequences M3XV85
ENSMPUP00000002985 ENSMPUP00000002985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]