SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003154 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003154
Domain Number 1 Region: 589-957
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.62e-125
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 87-187
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-17
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003154   Gene: ENSMPUG00000003187   Transcript: ENSMPUT00000003219
Sequence length 959
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897039.1:5216107:5382781:-1 gene:ENSMPUG00000003187 transcript:ENSMPUT00000003219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDEKGISPAHKTSTPTHRSASSSTSSHRDSRQSIHVLERTASSSTEPSVSRQLLEPEP
VPLSKEADSWEIIEGLKIGQTNVQRPDKHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSK
APLDIQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHR
LYRQNEIVRSPRDASFHIFPSTSTAESSPAANVSVVDGKVPPNNFPWQSPLPCSNSLPAT
CTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQAN
CVDISKKDKRVTRRWRTKSVSKDTKIQLQEGPSAKGQFSTTRRRQRLAAAVATTVPFSAT
MSPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNS
IAIEKEKLKQMVSEQDHNKGHSTQMARLRQSLSQALNQNAELRSRLNRIHSESIICDQVV
SVNIIPSPDEAGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENEASDD
ESYISDVSDNISEDNTSVADNISRQILNGELTGGAFRNGRRTCLPAPCPDTSNINLWNIL
RNNIGKDLSKVSMPVELNEPLNTLQHLCEEIEYSELLDKASETDDPYERMVLIAAFAVSG
YCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIR
WKNKFWGKSMEILPVGTLNVMLPKYGDCYVWNKVTTCIHNILSGRRWIEHYGEVTIRNTK
SSVCICKLTFVKVNYWNSNVNEVQGVVMDQEGKVVHRLFGKWHEGLYCGVAPSAKCIWRP
GSMPTNYELYYGFTRFAIELNELDPVLKDLLPPTDARFRPDQRFLEEGNLEAAAAEKQRV
EELQRSRRRYMEENNLEHIPKFFKKVIDANQREAWVSNDTYWELRKDPGFSKVDSPVLW
Download sequence
Identical sequences M3XVQ4
XP_004769039.1.14098 ENSMPUP00000003154 ENSMPUP00000003154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]