SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003211 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003211
Domain Number 1 Region: 319-396
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.92e-23
Family Intermediate filament protein, coiled coil region 0.0000878
Further Details:      
 
Domain Number 2 Region: 89-122
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000204
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003211   Gene: ENSMPUG00000003244   Transcript: ENSMPUT00000003276
Sequence length 544
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896992.1:2775100:2778899:1 gene:ENSMPUG00000003244 transcript:ENSMPUT00000003276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFSYDPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SSSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQAQIQY
AQISVEMDVSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVR
AAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELR
TTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVF
GRSAYGGLQTSSYLMSARSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEE
EKEKEEAAEEEGAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKDEGAGEEQAT
KKKD
Download sequence
Identical sequences M3XVW1
ENSMPUP00000003211 XP_004763307.1.14098 ENSMPUP00000003211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]