SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003224 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003224
Domain Number 1 Region: 184-278
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 108-159
Classification Level Classification E-value
Superfamily L27 domain 4.71e-21
Family L27 domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003224   Gene: ENSMPUG00000003256   Transcript: ENSMPUT00000003289
Sequence length 303
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:1727870:1732558:-1 gene:ENSMPUG00000003256 transcript:ENSMPUT00000003289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXXXXXXXXXXRGAAVCGCGRVRGLSGPRSGAHRTALPVCVWGSGGAGLRPQSPLP
PATLRVSYWDSAVFPGICQCSPLLGFWPHRSVLIRVSDSVSAPRPRPADVSRAVELLERL
QRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVAAFTA
SEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVN
GVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQHQSYSSLE
SRG
Download sequence
Identical sequences M3XVX4
ENSMPUP00000003224 ENSMPUP00000003224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]