SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003424 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003424
Domain Number 1 Region: 28-295
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.29e-90
Family Calponin-homology domain, CH-domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 310-432
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-33
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 3 Region: 920-1075
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-29
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 4 Region: 2225-2328
Classification Level Classification E-value
Superfamily PH domain-like 9.53e-29
Family Pleckstrin-homology domain (PH domain) 0.00000358
Further Details:      
 
Domain Number 5 Region: 1027-1181
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-26
Family Spectrin repeat 0.0000364
Further Details:      
 
Domain Number 6 Region: 1658-1810
Classification Level Classification E-value
Superfamily Spectrin repeat 1.69e-26
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 1239-1392
Classification Level Classification E-value
Superfamily Spectrin repeat 5.98e-26
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 8 Region: 1868-2023
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-25
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 9 Region: 710-826
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-24
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 10 Region: 544-653
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-21
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 11 Region: 1495-1607
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-20
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 12 Region: 1394-1506
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-20
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 13 Region: 442-540
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-19
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 14 Region: 2028-2089
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000115
Family Spectrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003424   Gene: ENSMPUG00000003455   Transcript: ENSMPUT00000003491
Sequence length 2477
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:4334965:4374488:-1 gene:ENSMPUG00000003455 transcript:ENSMPUT00000003491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQPPRSRRPPTTMSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSR
IKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPT
KGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISV
ETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFES
LKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALA
VEGKRIGKVLDHAMEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSF
NSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEH
ERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKH
EAIETDIVAYSGRVQAVDAVAAELAAERYHDIRRIAARQHNVARLWDFLRQMVAARRERL
LLTLELQKVFQDLLYLMDWMEEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERV
RAVSASALRFCDPSKEYKPCDPQLVSERVASLEQSYEALCELAATRRARLEESRRLWRFL
WEAGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGRQL
VAEGHPGASQAAARTAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDAL
RLVSSPELGHDEFSTQALARQHRALEEEIRSHRPALDALRDQAAALPPALSRTPEVQGRV
PSLERHYEELQAQAGERARALEAGLALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDL
EVVQQRFETLEPEMNALAARITAVNDIAEQLLKAKPPGKDSIVTTQKQLNHRWQQFRTLA
DGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERD
LEAIAARVGELAREADALAAGHPTQAPAIHARLGEVQAGWEDLRATMRRREESLGEARRL
QDFLRSLDDFQAWLGRTQTSVASEEGPATLPEAEALLAQHAGLRGEVERARGEYSRLRAL
GEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGV
LSSQDYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANGERIRGLLESGRQLVSGGNIHAE
KIQEKADSIERRHKKNQEAVQQLLGRLRDNREQQHFLQDCQELKLWIDEKMLTAQDVSYD
EARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLDDLHKRWDR
LESTTQAKARSLFDANRAELFAQSCSALESWLESLQAQLHSDDYGKDLTSVNILLKKQQM
LEREMAVREKEVEAIQAQATALAQEDQGAGEVERTSRAVEEKFRALCQPMKERCQRLQAS
REQHQFHRDVEDEILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADL
TERQRALGTAAAGPELAELQEMWRRLGRELELRGKRLEDALRAQQFYRDAAEAEAWMGEQ
ELHMMGQEKAKDELSAQAAVKKHQGLEQALADYAQTVRQLAASSQDMIDHNHPESTRISI
RQAQVDKLYASLKELAGERRERLQEHLRLCQLRRELDDLEQWVQEREVVAASHELGQDYE
HVTMLRDKFREFSRDTSTIGQERVDGANALANGLIAGGHAARATVAEWKDSLNEAWADLL
ELLDTRGQVLAAAHELQRFLHGARQALVRVQHKQQQLPDGTGRDLNAAEALQRRHCAFEH
DIQALSTQVQQVQDDGLRLQKAYAGDKAEEIGRHMQAVAEAWTQLQGSSAARRQLLLDTT
DKFRFLKAVRELMLWMDGVNLQMDAQERPRDVSSADLVIKNHQGIKAEIEARADRFSSCI
DMGQGLLARSHYAAEEISEKLSQLQARRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEA
WLCSQEPLVRSAELGCSVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEEQEKERKR
KRDEEERRKQPPAPEPTAGRPAGDLVDSQTAPGAAWDGTHPRLPASTQQASVNGVCADAE
TPQPLSEQQRLEQGTFGEGPGSGPGDEANGPRGDKQSRTRGPAPPAMPQSRSSESARVAT
LPPRGPELSAQEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAG
VPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEETARDCQQGPPSCQ
DNCLLLGSIAKVSPSPGTVSEDKSVFPRATLLSCYLIPDWWWDPGDPQFHSRLPSSSLSP
QPCAPTPSRVRTALHPPRRPRGNGCPCLRSLPHRREGTSLSPLPLGTSQEPVRAEAGPGG
EVARWPSQSPRSSPFPP
Download sequence
Identical sequences M3XWH4
ENSMPUP00000003424 ENSMPUP00000003424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]