SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003502 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003502
Domain Number 1 Region: 8-118
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-27
Family Phosphotyrosine-binding domain (PTB) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003502   Gene: ENSMPUG00000003532   Transcript: ENSMPUT00000003569
Sequence length 700
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896927.1:662932:740307:1 gene:ENSMPUG00000003532 transcript:ENSMPUT00000003569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLSLLPLQYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKKKEWTWDESKMLVMQDPIYR
IFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQH
TQQNADGQEDGESERNSSSSGDPGRQLPGAERASSATAEETDIDAVEVPLPGNDILEFSR
GVTDLDAVGKEGGSHPDPKASPHPPEPMLAASPRMLLPSCSAKPPGLGPGTPLSSHHQMQ
LLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDLLQHISLLVK
QVQELELKLSGQNAMGSQDSLLEITFRSGGLPVLCDPTTPQPEDLPSPPPGAGLAELAHP
ASSPLGRRDCLVKLECFRFLPPPAGPLLGGLELLKFRESGIASEYESNTDESEERDSWSQ
EELPRLLNVLQRQELGDSLDDEIAVLDHGMFENVNAAHAPKLQPSCSFPHLSRLAAPSSA
APGSGVWVGSSQHLKNLGRAVGAKVNDFLRRKEPSSLDGAGAMEINRTAGARLAGGVPGQ
EARSALPDAFPRLDPPPPITRKRTPRALKTTQDMLISSQPVLSSLEYGTELSPGQPQDPL
PTAPPEAPLEVVDKGEALPNGEVSVSVPDLIHQDGQDEPKPKMTECRRASSPGLLERNGL
KLSLSRPDLAEPLEDGSSPPRARTSSLDNEGPHPDLLSFE
Download sequence
Identical sequences M3XWQ2
ENSMPUP00000003502 ENSMPUP00000003502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]