SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003576 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003576
Domain Number 1 Region: 12-112
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-27
Family SH2 domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003576   Gene: ENSMPUG00000003605   Transcript: ENSMPUT00000003643
Sequence length 143
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896927.1:745006:768488:-1 gene:ENSMPUG00000003605 transcript:ENSMPUT00000003643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYRAPSRLAVDLPYYHGPLSKKDCETLLLQDRVDGNFLIRDSESVPGVLCLCVSFKNFV
YTYRIFKDGRGFYNIQTVEGAPQMLFSNLKELISTFEKPNQGLVVQLRHPIKQASSRPRW
RRSQIQLDSIYENSNSDYVEVLP
Download sequence
Identical sequences M3XWX6
ENSMPUP00000003576 ENSMPUP00000003576 XP_004751467.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]