SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003757 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003757
Domain Number 1 Region: 187-253
Classification Level Classification E-value
Superfamily Homeodomain-like 1.45e-19
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 61-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000154
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000171
Family LIM domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003757
Domain Number - Region: 122-150
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.018
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003757   Gene: ENSMPUG00000003787   Transcript: ENSMPUT00000003825
Sequence length 382
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896927.1:2898539:3053437:-1 gene:ENSMPUG00000003787 transcript:ENSMPUT00000003825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDGLKMEENFQSAIETSASFSSLLGRAVSPKSVCEGCQRVISDRFLLRLNDSFWHEQCV
QCASCKEPLETTCFYRDKKLYCKYDYEKLFAVKCGGCFEAIAPNEFVMRAQKSVYHLSCF
CCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHG
AGKGAAEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQ
VWFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGSGNAGMEGIMNPYTALPTPQQLL
AIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGP
LQSRVGNPIDHLYSMQNSYFTS
Download sequence
Identical sequences F1PDJ1 M3XXF7
ENSMPUP00000003757 ENSCAFP00000019634 XP_004751491.1.14098 XP_851352.2.84170 ENSCAFP00000019634 ENSMPUP00000003757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]