SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003777 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003777
Domain Number 1 Region: 509-687
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-45
Family SPRY domain 0.0026
Further Details:      
 
Domain Number 2 Region: 196-261
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-17
Family B-box zinc-binding domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 32-119
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000117
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 4 Region: 406-514
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000184
Family Fibronectin type III 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003777
Domain Number - Region: 137-192
Classification Level Classification E-value
Superfamily RING/U-box 0.00247
Family ZZ domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003777   Gene: ENSMPUG00000003808   Transcript: ENSMPUT00000003846
Sequence length 716
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897040.1:1435766:1528683:1 gene:ENSMPUG00000003808 transcript:ENSMPUT00000003846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGQTATEQGRGESPASVVLNAPAGLFSLKMETLESELTCPICLELFEDPLLLPCAHSL
CFSCAHRILVSSCSSGESIEPITAFQCPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKA
SVSGPNSPSESRRERTYRPSTAMSSERIACQFCEQDPPRDAVKTCITCEVSYCDRCLRAT
HPNKKPFTSHRLVEPVPDTHLRGITCLDHENEKVNMYCVSDDQLICALCKLVGRHRDHQV
ASLNDRFEKLKQTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLMEECDEL
VEIIQQRKQMIAVKIKETKVMKLRKLAQQVANCRQCLERSTVLINQAEHILKENDQARFL
QSAKNIAERVAMATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIRE
ELCTASHDTITVHWISDDEFSISSYELQYTIFTGQANFISLYNSVDSWMIVPNIKQNHYT
VHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKD
ESSLKKSHTPERFSGAGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWIG
KNASSWVFSRCNSNFVVRHNNKEMLVDVPPQLKRLGVLLDYDNNMLSFYDPANSLHLHTF
DVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKACH
Download sequence
Identical sequences M3XXH7
ENSMPUP00000003777 ENSMPUP00000003777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]