SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004020 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004020
Domain Number 1 Region: 212-341
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.61e-20
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.024
Further Details:      
 
Domain Number 2 Region: 484-537
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000331
Family Tudor domain 0.019
Further Details:      
 
Domain Number 3 Region: 55-122
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000000432
Family Gtf glycosyltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004020   Gene: ENSMPUG00000004054   Transcript: ENSMPUT00000004093
Sequence length 1122
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897040.1:4694480:4761089:1 gene:ENSMPUG00000004054 transcript:ENSMPUT00000004093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCVFVTVGTTSFDDLIARVSAHDTLQIFKSLGYNRLVLQIGRGKLVPEPFSTESFALDV
YRYKDSLKEDLQKADLVISHAGAGSCLETLEKRKPLVVVVNEKLMNNHQLELAKQLHKDG
HLFYCTCRIPTCPGQASPLLLLLRSAKILQRLLSGYLHKQALVTATHFYLHPAFSFLPRL
CSFLPLPTSTSAKMHKGWKKYCGQKSLNEASMDEYLGSLGLFRKLTAKDASCLFRAISEQ
LFCSQVHHLEIRKACVSYMRENQHTFESYVEGSFEKYLERLGDPKESAGQLEIRALSLIY
NRDFILYRYPGKPPTYVTDNGYEDKILLCYSSNGHYDSVYSKQFQSSAAVCQAVLYEILY
KDVFVVDEEELKTAVELFRSGSKKNRNNALTGSEDVNIDYKSSTQDRTEELGACCNAENI
PEGYNQGTEEAKSPEGPSKMLFPYKVLKALDPEIYRNVEFDVWLDSRKVELQKSDYMEYA
GRHYYLGDKCQVRLESGGRYYNAHIQEVGNENNSVTVFIEELAEKHMVPLANLKPVTQVT
PVPAWNAMPSRKGRGYQKVSGGYVPEEAVSEMDMKQRKKMFKKVRGKEVYMTMAYSRGDT
LLPPRLQHSMHYGHDPPMHYPQTAGSIMSNEHFHPQHASQRQGRGYGMPRDSSRFINRHN
MEGPKVGFYPGPGKRCCQSYDNFSYRSRSFRRSHRQMHCMNKECQYSFAPESGQMPRGLE
ETITFYEVEEGDETAYPPLPNHGGPTTMVPAASRYCVARRGHSSSKQTLNSEEGSGQTDS
GRYHEEYIYPSEPDYETSGVYSTTESTANLSLQDRRPCSMSPQDTVTSYSYPQKVMVNSS
AVAASCANNVPASVLPNCAVANQASSTTSVSSQNVMQPLFVSPPMQGRPEYLEIIKAFSL
GILVIASPSYPYLSAPIPAAAGSLPPPPPPPPLEVGEASNLPPPPPPYSCDPSGSDLPQD
TKVLQYYFNLGLQCYHHNYWHSMVYVPQMQQQQHLHVENYPVYSEPSPLVEQTVPQLYGE
VGRQEGTQVEATTNGTFPNADPASVPHGAVYYPMMSDPYGPPPLPGFDSCLPVVPDYPYV
APWHPVGAAYGGSSQIHGAMNPGPVGYIASPPSASHYLPQNM
Download sequence
Identical sequences M3XY69
ENSMPUP00000004020 ENSMPUP00000004020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]