SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004138 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004138
Domain Number 1 Region: 910-1201
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.62e-88
Family Complement components 0.0000174
Further Details:      
 
Domain Number 2 Region: 1282-1410
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.27e-30
Family Alpha-macroglobulin receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 739-777
Classification Level Classification E-value
Superfamily E set domains 0.00000168
Family SVA-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004138   Gene: ENSMPUG00000004172   Transcript: ENSMPUT00000004211
Sequence length 1448
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897054.1:4414921:4551004:-1 gene:ENSMPUG00000004172 transcript:ENSMPUT00000004211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGWGLLTAAHLVCVWTSELFRPRFLVTAPGIVRPGGNVTIGVDLLERSPPQVTVKAELV
KMAANLTVSVLEAEGVFEKGSFKTLTLPSLPLNSADGIYELRVTGWAQDEILFSNSTRLS
FETKRMTVFIQTDKSLYKPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWLSER
SDLGVVSKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSLNS
RSLNGTVTAKYTYGKPVKGDVTLTFLPLSFWGMKKNITKNFKINGSANFSFNDEEMKKVM
DFSEGLSEHMYLSSPGPVEILATVTESLTGISRNASSNVFFKQHDYIIEFFDYATVLKPS
LNFTATVKVTRADGNQLTFEERRNNVVITVTQKNSSEYWNRWNSRNQETGAVQIKNYTLP
QNGIFKIEFPILDDSNELQLKASFLNSVSSMAVHGMFKSPSQTYIQLKTRDENVKVGSPF
ELVVSGNKQLKELSYMVVSRGRLVAVGKQNSTTFSLTPENSWAPKACIIVYYIEDDGEII
NDVLKLHVQLVFKNKIKLFWSKTQAEPSERVSLRISVTQPDSTVGIVAVDKSVNLMNVSN
DITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLLKDYIDGVYDSVEFLER
FAEETEGYLVDFHDFSSVSNPRIRKHFPETWIWLDTNMGSRIYQEFEFTVPDSITSWVAT
AFVISEDLGLGLTSSPVELQAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKEATEVLLI
IHTSGRSFSFLPPCTFSSSSLLLEGVASSHCPSVLLAVGIKNSRYLSNCIHTVNTADRGV
EMMSTDINRVPFFLQAEGIEKSYSQSILLDLTDNKLQTLLKTLSFSFPPNTVSGSERVQI
TAIGDILGSSINGLASLIRMPYGCGEQNMINFAPNIYVLDYLTKKRQLTEDLKEKALSFM
RQGYQRELLYQREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWL
KGRQKSNGEFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYKKYQPNIDVQESINFLES
EFNRGISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQEGGMQFWVSSEPKLSESWQP
RSLDIEVAAYALLSHFLQYQVSEGIPIMRWLSSQRNSLGGFASTQDTVVALKALSEFAAL
MNTDRTNIQVTVTGPSSPSPVKFWIDTQNRFLLQTSELAVAQPIAVNISASGVGFAICQF
NVIYNVKDSGSPRRRRSIQDQEAFDLDVAVKDNKDDTNHLNLNVCTRFLGPARSGMALME
VNLLSGFTVPSDAIPLSETVRKVEHDHGKVNLYLDSVNETQICVDIPAVRNFKVSNTQDA
LVSITDYYEPRRHTVRSYNSEVKLSSCDLCADVHGCGPCERGAAASLYPASAIVVLGVAL
LFSLQCGL
Download sequence
Identical sequences M3XYI7
ENSMPUP00000004138 ENSMPUP00000004138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]