SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004168 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004168
Domain Number 1 Region: 460-543
Classification Level Classification E-value
Superfamily DEATH domain 3.01e-20
Family Caspase recruitment domain, CARD 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004168   Gene: ENSMPUG00000004202   Transcript: ENSMPUT00000004243
Sequence length 545
Comment pep:novel scaffold:MusPutFur1.0:GL897027.1:2337594:2360493:1 gene:ENSMPUG00000004202 transcript:ENSMPUT00000004243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDRSWRCCLTWRRLCGWCCFGSKEEPARELNYKSGRGRKAVLPLSLLSLPFPRSDSGY
CEESLSSTFKTSNNSSQVCPSSESEELLTGEPTLHIPPGLLSWWSGGFHETRALVVTSLR
RRVPGSSKSADQESSQTQESEETCLEEKTLVPLEAPKLFSGVGPACHSYQFLGPEGNVDI
ELIDESANRYSVHFPMAGFYLWPTTRLGFLVTAAVTVRIALDSWSLHMKLQHEKQWMVAG
PLFDISVEPEGVIAEIHLPHIISLPANEVDMSWFHVAHFKDEGMVLEPPARVECFYAVLE
NPSFSLMGILLRLASGARVSVPITSTALLYYHFYPEDTKFHLYLIPSDSLLTKAIDEEET
KFHGVRLQTSPPVEPLNFGSRYIVSGSAHLEIMPEELKLSYRSPGEIQVFSKVFAGKMEE
PIILEVTDKRHKTLVWRTLVKPVELQFYAASPPSPLSAEAFMKENHRHLQARLGDLSGVL
DDLQDSGVFTEEEKELVQQFPTRQRKNETLLRMVEKKGPQALEIFFRSLQQRDPYLMSYL
SQQSL
Download sequence
Identical sequences M3XYL7
ENSMPUP00000004168 ENSMPUP00000004168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]