SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004534 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004534
Domain Number 1 Region: 658-845
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.68e-59
Family Nucleotide and nucleoside kinases 0.000000147
Further Details:      
 
Domain Number 2 Region: 374-473
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-33
Family PDZ domain 0.0000283
Further Details:      
 
Domain Number 3 Region: 476-590,651-685
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-31
Family SH3-domain 0.0000956
Further Details:      
 
Domain Number 4 Region: 221-316
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-27
Family PDZ domain 0.0000226
Further Details:      
 
Domain Number 5 Region: 110-221
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-27
Family PDZ domain 0.0000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004534   Gene: ENSMPUG00000004569   Transcript: ENSMPUT00000004613
Sequence length 849
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897138.1:519016:573693:1 gene:ENSMPUG00000004569 transcript:ENSMPUT00000004613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASGGYGGYSSQTLP
SQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQV
NGSDGMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVN
DCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPETIMEVNLLKGPKGLGFSI
AGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKN
TSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPP
QAPPARYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPA
DLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDL
REQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASD
DEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRSIKTKRKKS
FRLSRKFPFYKSKENMAQESSIQEQGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYAR
PVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQD
NKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSI
EALMEMNRRQTYEQANKIFDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHY
IWVPSPEKL
Download sequence
Identical sequences M3XZN3
ENSMPUP00000004534 ENSMPUP00000004534 XP_004777254.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]