SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004550 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004550
Domain Number 1 Region: 796-1009
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.54e-78
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000000037
Further Details:      
 
Domain Number 2 Region: 661-797
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 6.67e-49
Family Domain of poly(ADP-ribose) polymerase 0.000000173
Further Details:      
 
Domain Number 3 Region: 519-642
Classification Level Classification E-value
Superfamily WGR domain-like 8.5e-41
Family WGR domain 0.000000235
Further Details:      
 
Domain Number 4 Region: 110-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.03e-31
Family PARP-type zinc finger 0.0079
Further Details:      
 
Domain Number 5 Region: 7-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.27e-30
Family PARP-type zinc finger 0.0066
Further Details:      
 
Domain Number 6 Region: 383-464
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000712
Family DNA ligase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004550   Gene: ENSMPUG00000004585   Transcript: ENSMPUT00000004629
Sequence length 1013
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896982.1:1873401:1910693:-1 gene:ENSMPUG00000004585 transcript:ENSMPUT00000004629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGGGGKTDKTLADFAAEYAKS
NRSTCKGCMEKIEKGQIRLSKKMLDPEKPQLGMIDRWYHPDCFVRNREELGFRAEYSASQ
LKGFSLLAAEDKETLKKQLPGVKSEGKRKGDEVDGMDEVAKKKSKKEKDRDSRLEKALKA
QNELIWSIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPSRKDWVTPKEFREISYLKKLKIKKQDRIFPPE
TSAPVVAAPPSTASAPAGVNSSTPPDKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTG
TANKASLCISTKKEVDKMSRKMEEVREAGIRVVSEDFLHDVSSSTKSLPDLLSAHLLAPW
GAEVKAEPEEPAVSRAKSGSALSKKSKGPVKEEGINKSEKRMKLTLKGGAAVDPDSGLEH
SAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDRESRYWIFRSWGRVGTVIGSNKL
EQVPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEDAVKKLTVNPGT
KSKLPKPVQELIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVS
QGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADCVQAKVEMLDNLLDIEVAYSLLRGG
SDDSSKDPIDVNYEKLKTDIKVVDRDSEEAETIRKYVKNTHATTHNAYDLEVVDIFRIER
EGESQRYKPFRQLHNRRLLWHGSRATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMV
SKSANYCHASQADPVGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSAS
ITMDGVEVPLGTGVSSGVNDTCLLYNEYIIYDVAQVNLKYLLKLRFNFKTSLW
Download sequence
Identical sequences M3XZP9
ENSMPUP00000004550 XP_004761981.1.14098 ENSMPUP00000004550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]