SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004665 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004665
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily DEATH domain 8.48e-32
Family DEATH domain, DD 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004665   Gene: ENSMPUG00000004702   Transcript: ENSMPUT00000004746
Sequence length 216
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:6733589:6736555:1 gene:ENSMPUG00000004702 transcript:ENSMPUT00000004746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFLVLLHSVSTGLSDDELTELKFLCRARVGKRKLESVRCGLDLFAVLLEQNELDAERP
ELLRELLASLRRHDLLRRLDAFEAGAAGRAPPEEPDLRAAFDIVCDNVGRDWRRLARHLH
VTDTKIDAIEEKYPRNLTEQVRESLRVWKSAEREDATVSHLVRALRACQLNLVADLVLED
QQARENETAGSGGGDKSPAESLTSWDSNGPALGGPW
Download sequence
Identical sequences M3Y014
ENSMPUP00000004665 ENSMPUP00000004665 XP_012915473.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]