SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004925 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004925
Domain Number 1 Region: 279-397
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-46
Family MBT repeat 0.0000393
Further Details:      
 
Domain Number 2 Region: 166-279
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.78e-41
Family MBT repeat 0.00000602
Further Details:      
 
Domain Number 3 Region: 383-505
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.25e-36
Family MBT repeat 0.0000511
Further Details:      
 
Domain Number 4 Region: 640-713
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.29e-16
Family SAM (sterile alpha motif) domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004925   Gene: ENSMPUG00000004964   Transcript: ENSMPUT00000005009
Sequence length 728
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:10355952:10793707:1 gene:ENSMPUG00000004964 transcript:ENSMPUT00000005009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRIQICVVSEPAGKQLWGVPVLILSLGDSPRPETLSGPATTNHCLPSWFLLLFLCYSL
YDKSPLTKNTFALALVDSQTIKTLLRSAQVAMKQPNRKRKLSMDSKEHLNQDGCLEQAEE
DKKPRDGATPLSHVPSVAAQEAWSWEQYLTEQKAIAAPVELFSKDQSFPEHENGFQVGMR
LEGIDPRHPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCEKTKHEL
HIPKGYRKDKFVWMDYLKACKLQNAPKKLFRNRSSNGPMPKEFQVGMKLEAVDRKNPSLV
CVATIADIVEDRLLVHFDNWDDSYDYWCDVNSPYVQPVGWCQENGRTLIAPQGYPDPENF
SWTEYLEATQTNAVPAKVFKMRTPHGFLPSMRLEAVDRRNPRLIRVATVIDVDDQRVKVH
FDGWDHKYDYWMDADSPDIHPIGWCDITGHPLEIPYRANDVKILPGQAVCPTPGCRGIGH
IRGPRYSGHHSAFGCPYSDMNLKKEATLHDRLREQTQANLEPDSSHSKPKNICGLNFNGK
HEMVNSQPRLVQQAKCLKIKGKEDIDLDNLFRGGDSGKSLTRQEEICVLVPTLQTKYSAE
QTQQVLHQSIFMSSVSAHPFRDLPLGREQHCKLLPGVANIQASEVARWTVDEVAEFVQSL
LGCEEHAKCFKKEQIDGKAFLLLTQTDIVKVMKIKLGPALKIYNSILMFRNSQDLTEEDS
LSGQEARG
Download sequence
Identical sequences M3Y0S4
ENSMPUP00000004925 ENSMPUP00000004925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]