SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004983 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004983
Domain Number 1 Region: 565-1037
Classification Level Classification E-value
Superfamily Ras GEF 2.48e-135
Family Ras GEF 0.000000000000385
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 3.07e-51
Family TBP-associated factors, TAFs 0.000000255
Further Details:      
 
Domain Number 3 Region: 204-393
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-40
Family DBL homology domain (DH-domain) 0.000000195
Further Details:      
 
Domain Number 4 Region: 416-571
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-37
Family Pleckstrin-homology domain (PH domain) 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004983   Gene: ENSMPUG00000005022   Transcript: ENSMPUT00000005068
Sequence length 1281
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:4986887:5062189:-1 gene:ENSMPUG00000005022 transcript:ENSMPUT00000005068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPTLSANEESLSYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYQVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPTSSGELNYYDLIRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
DRIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEDQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKDDTCEYKNAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPDVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
IEKGEQPVSADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
DAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKMSFSRIAETDLESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGNTKSDDDPPAIPPRQPPPPKPPPLGHLHRDPDWFRD
VSTCPNSPNTPPSTPSPRVPRRCYMLSSSHNNLAHPQAPPVPPRQNSSPHLPKLPPKTYK
RELSHPPSYRLPLLENAETPQ
Download sequence
Identical sequences M3Y0Y2
ENSMPUP00000004983 ENSMPUP00000004983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]