SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005064 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005064
Domain Number 1 Region: 142-443
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.27e-111
Family Pancreatic carboxypeptidases 0.0000000075
Further Details:      
 
Domain Number 2 Region: 46-137
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.47e-27
Family Pancreatic carboxypeptidase, activation domain 0.00000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005064   Gene: ENSMPUG00000005102   Transcript: ENSMPUT00000005149
Sequence length 448
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:9827986:9837660:-1 gene:ENSMPUG00000005102 transcript:ENSMPUT00000005149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRHLTWESLKGPRTFSETQLMFPVGCSMRGLLVLSVLLGAVLGKEDFSGHQVLRLSTA
DAAQVEKVKELEDLEHLQLDFWRGPAQPGSPIDVRVPFRSIQAVKIFLEAHGIGYTTMIE
DVQALLDEEQEQMFAFQARARSSDTFNYATYHTLEEIYGFMDMLVAEHPQLVSKLQIGNS
YEGRPIYVLKFSTGGENRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDSTLTAILD
SMDILLEIVTNPDGFAFTHSKNRMWRKTRSLTAGSSCVGVDPNRNWDAGFGMAGASSNPC
SETYHGKFANSEVEVKSIVDFVKNHGNIKAFISIHSYSQLLLYPYGYKAEAAPDRDELDQ
LAKSAVTALASLYGTKFKYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLL
PASQIVPTAQETWLALRTIMEHTLQHPY
Download sequence
Identical sequences M3Y163
ENSMPUP00000005064 ENSMPUP00000005064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]