SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005563 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005563
Domain Number 1 Region: 370-558
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.38e-66
Family Regulator of G-protein signaling, RGS 0.00000793
Further Details:      
 
Domain Number 2 Region: 768-997
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-63
Family DBL homology domain (DH-domain) 0.000000000968
Further Details:      
 
Domain Number 3 Region: 1001-1131
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-39
Family Pleckstrin-homology domain (PH domain) 0.00000125
Further Details:      
 
Domain Number 4 Region: 69-149
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005563   Gene: ENSMPUG00000005607   Transcript: ENSMPUT00000005659
Sequence length 1544
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896924.1:8907968:9052690:1 gene:ENSMPUG00000005607 transcript:ENSMPUT00000005659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSVVGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTSSRPLGDPLPVSEAEADPGDGLGRIDYSSGDAS
RPSSDSADSPKSSLKERICLEENPEKSEAIQDPDTQSLIGSPSPRVAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
VFLEFHQFFLDRSAHLKVSVPDEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAEREKDRVTLEKERACAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKQRHPKHLSTPSSVSPEPPDPAKLRQSGLAGEGTDVGY
LPANSMSSVAAGATLAQEGGGKENDTGSKQAGETAASGDCVDSTPRTPNTVFDFPPPPLD
QVQEEEWEVERVTEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLL
GLKPSEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDIL
QLHIGLNEQMKAVRKRNETSVIDQIGEDLLIWFSGPGEDKLKHAAATFCSNQPFALEMIK
SRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTELPMEREK
VKKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRK
MIHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPV
IKLNTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSA
KPIPLPQSSPCEGDNDEETAPKLKVEHHSISVPGLQSPDRDLGLESPLISSKPQSHSLGT
SGKSEVDDLFVAERQLVKEQQEDGTLQEAGASYQTPGPDPHLPASDERWALDALRNLGLL
KQLLVQQLGLTEKSSQEDWPHFPRYRTASSGVQTDSGAQNSENSKAYPPGEGHMPFRTGT
GDAAPCYSPRTSAESSTPRDSVVLAFQDSQASNILVMDHMLRTPEMPPAEPEGSLDESGE
HFFDAREAHSDDNPSEGDGAVKKEEDVNLRISGNYLILDGYDAVQESSTDEGLASSLPLP
PTTGTPSTDSARPQQHSPQHTHSDGAASPFSPEFLVQQRWGAMEDSCFEIQSPPSCADSQ
SQIMEYIRKIEADLEHLKKVEESYSTLCQRLAGSALTDKHSDKS
Download sequence
Identical sequences M3Y2L2
XP_004750127.1.14098 ENSMPUP00000005563 ENSMPUP00000005563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]