SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005608 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005608
Domain Number 1 Region: 527-746
Classification Level Classification E-value
Superfamily Bet v1-like 3.37e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 96-246
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005608   Gene: ENSMPUG00000005653   Transcript: ENSMPUT00000005705
Sequence length 755
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897022.1:4310044:4422555:1 gene:ENSMPUG00000005653 transcript:ENSMPUT00000005705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQNGNSIPPPFSAPPTIPLCVIRENRRLASKGLSSGGGAGRSAGVTTTATADGWKGRLP
SPLVLLPRSARCQARRRRRSGQTSSLLQLPPKPERAFFPSPSPGPLPRVLGASSGAAQGA
GAGLLIDCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKN
NTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWI
DAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRD
ILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNANGNKEKLFP
HVTPRGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKRRRIEE
AYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHW
PTSMPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSL
QDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRN
DWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWA
PASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences M3Y2Q7
ENSMPUP00000005608 ENSMPUP00000005608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]