SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005698 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005698
Domain Number 1 Region: 246-555
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.65e-116
Family Transglutaminase core 0.000000018
Further Details:      
 
Domain Number 2 Region: 96-245
Classification Level Classification E-value
Superfamily E set domains 1.43e-45
Family Transglutaminase N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 681-780
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-29
Family Transglutaminase, two C-terminal domains 0.00059
Further Details:      
 
Domain Number 4 Region: 569-680
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.49e-28
Family Transglutaminase, two C-terminal domains 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005698   Gene: ENSMPUG00000005745   Transcript: ENSMPUT00000005797
Sequence length 809
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896946.1:6531461:6545121:1 gene:ENSMPUG00000005745 transcript:ENSMPUT00000005797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRMSRRGGRSFWARCCPCCSCRNGTDEPY
GGRGSRSGSRRPDSRGSGSRRPGSRTGDVNAAGDGTIREGMLVVTGVDLLSARSDQNRRE
HHTDEFEYDELIIRRGQPFHVVLHFSRPYESSDHVALELLIGNNPEVGKGTHVIIPVGKG
SSGGWKAQVTKASGQNLNLRVHTSPNAIIGKFQFTIRTRCEAGEFQLPFDPSNEIYILFN
PWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRR
GMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRT
GYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLN
HDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMK
YDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIITKAIGSNMRDDVTHMYKHPE
GSEAERRAVETAAAHGSKPNVYSSRDSAEDVAMQVEAQDAVMGQDLAVSVVLSNRGGSPR
TVKLHLYLSVTFYTGVTGPVFKESKKEVVLAPGASDRVSMPVAYKEYRPHLVDQGSMLLN
VSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFRNPLPVTLTNVVFRL
EGSGLQRPKILNVGDIGGNETVTLHQKFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAP
APRGGGVFADAGGDSHSGETIPMASRGGA
Download sequence
Identical sequences M3Y2Z7
ENSMPUP00000005698 XP_004755273.1.14098 ENSMPUP00000005698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]