SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005739 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005739
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.85e-19
Family THAP domain 0.00059
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005739
Domain Number - Region: 177-217
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005739   Gene: ENSMPUG00000005786   Transcript: ENSMPUT00000005838
Sequence length 276
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897008.1:1132481:1145331:1 gene:ENSMPUG00000005786 transcript:ENSMPUT00000005838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKYCRAPNCSNTAGRLGADNRPVSFYKLPLKDGPRLQAWLRHMGHEDWEPSCHQHLCSE
HFTPSCFQWRWGVRYLRPDAVPSIFSPAPPAKRQQSSRNTEKPVVPPSPPEGTPLSPGPA
VSVSAPGPVPLVVLGSASGAPEATTTVFLTPLQPPPAPAGQQPGVRAQHPLARLDAVLGA
LRRRVRSLQRRQEQHELRLRALEQLAQQLCREGPPSPAARGLVMPRGYDFFWPQHQCLNP
ILCGVADKAVVIAQSPASPTLDAKPELQDRCQVPAA
Download sequence
Identical sequences M3Y338
ENSMPUP00000005739 ENSMPUP00000005739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]