SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005837 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005837
Domain Number 1 Region: 175-270
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000177
Family DEATH domain, DD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005837   Gene: ENSMPUG00000005885   Transcript: ENSMPUT00000005938
Sequence length 278
Comment pep:novel scaffold:MusPutFur1.0:GL896999.1:1121887:1164500:1 gene:ENSMPUG00000005885 transcript:ENSMPUT00000005938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSTTACAVLCHQKDNPRRVVILVVPSKDLSQVLRGLRLEAFSGPPEPSRPFQVKEGDQL
LLRFTGNIFASSNGKDYEKDFKLIFHLQRKPRLELQIKEVDEFGNYSCPHYKGTIVIYKI
PKEKVVHNLDQSLILDENHHHLPICKLPLKLPKHKKLINRPQSTKIISTDPVGALWDNLL
HWLAEELSEENAARLSSSLPVRRSTVELIRLKSPGDLTEQIHELLCFWKKSLPKSTDKVR
LLARHLRQIGRRDLAEELKFKWEQKVFTEPQQWFDKTE
Download sequence
Identical sequences M3Y3D6
ENSMPUP00000005837 ENSMPUP00000005837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]