SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006089 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006089
Domain Number 1 Region: 742-918
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-41
Family DBL homology domain (DH-domain) 0.0000828
Further Details:      
 
Domain Number 2 Region: 928-1043
Classification Level Classification E-value
Superfamily PH domain-like 2.5e-35
Family Pleckstrin-homology domain (PH domain) 0.00082
Further Details:      
 
Domain Number 3 Region: 191-332
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000968
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006089   Gene: ENSMPUG00000006141   Transcript: ENSMPUT00000006196
Sequence length 1202
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:18253580:18262004:1 gene:ENSMPUG00000006141 transcript:ENSMPUT00000006196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPAEIGDESPDSQGHATDWRFAVCSFRDAWDEGEPVSPMQVKDPNPLRPTAGTTEGEG
LQGSPLPGEPQSPPGQMAVDGSGDGQGSTLGGSSLQLEGPKPSGVESLLCPMSSHLSLAQ
GESDSQGGSLARDQAPSRLMPACVGPEGLDSDPVDPGGPLSQMSSELLEADLSGSSLPKP
ADYLLAQDLAWELLASGMATLPGTRDVEGRAVLLLCAHSPAWLHPKCSNHELIRLLLYLR
SIPRPEVQAMGLTVLVDAQVCSPSSSLFWGLSQLQEVAPGSVYQVLLLGKMPEDVPSRLQ
LQQLPSHQSLLNHVSTSGLPASMGGGLPYCHQAWLDFRMRLEALLQSCQVVCALLQGAIE
SMKAVPRPMEPGEVGRLLRQARVLMQHVLDSPRLAWLQGQGSLELAWLKQEVPEVTLSPD
YRPAVDEVDELYGRVDGLLHQLTLQSNRRIQALELVQTLEAQQGGLHQIEVWLQQVGWPA
LEELREPSLDMLLQAQGPFQDLDQVAQEQVRRGEKFLQPLAGWEAAELGPVGARFLALQA
QLTDFSRALARQRQRLADAEKLSHFFKQASTWAEAGQQVLAELEQEHPGVVLQRLQLHWT
KHPDLPPAHFRKMWALATGLGSESIRQECRCAWARCQDTWLALDQKLEAALKPPLTMTTT
MTGSTASLCVRRIPPASATPPLRKAHSLDQNLGQSLREPAHHCHHVATAATCHRPEAGGG
ARPGSSPPMPLPSISDPRSPSRLQLVLAEMVSTEREYVRALDYTMENYFPELERPDVPQG
LRGQRAHLFGNLEKLRDFHFHFFLRELEACTQHPSRVAYAFLRHRVQFGMYALYSKNKPR
SDALMTSFGHTFFKDKQQMLGDHLDLASYLLKPIQRMSKYALLLQELARACGGAVQELSA
LQAAQSLVRFQLRHGNDLLAMDAIQGCDVNLKEQGQLVRQDEFLVRTGRRKSLRRVFLFE
ELLLFSKPRRGPTGTDTFAYKRSFKMADLGLTECCGESNLRFEIWFRRRKARDTFVLQAA
SLATKQAWTADISRLLWRQAIHNKEVRMAEMVSMGVGSKAFRDIAPSKEAISDRTVNYVL
KCREVRSRASIAVAPFDCDSPYLGALSSLPGDPASCSVLGSLNLHLYRDPALLGLRWPLY
SASFPEEAALEAEVELGSQLSLTPEDSEVSSQCPSASGSSGSDSSCVSGQALGRGLEDLS
CV
Download sequence
Identical sequences M3Y438
XP_004744455.1.14098 ENSMPUP00000006089 ENSMPUP00000006089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]