SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006221 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006221
Domain Number 1 Region: 683-813
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.21e-30
Family Synaptotagmin-like (S variant) 0.00000213
Further Details:      
 
Domain Number 2 Region: 1494-1613
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-23
Family Synaptotagmin-like (S variant) 0.0088
Further Details:      
 
Domain Number 3 Region: 32-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.68e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0065
Further Details:      
 
Domain Number 4 Region: 516-645
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-16
Family PDZ domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006221   Gene: ENSMPUG00000006275   Transcript: ENSMPUT00000006330
Sequence length 1642
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897045.1:5195342:5693691:1 gene:ENSMPUG00000006275 transcript:ENSMPUT00000006330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPAACKTPRNAENQPHQPSPRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICH
KTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFF
GSGPQQPSQDGTLSDTATGAGSEVPREKKARLQERSRSQTPLSTAAATSQDTAPPSAQPD
RSKGAESSQQAVGPEQKPISSRSRSEPPRERKKTPGLSEQNGKGAPKSERKRVPKSSAPP
GEGAVEERERKERRESRRLEKGRSQDYPDVPEKREDRKAADDEKQRKEEEYQTRYRSDPN
LARYPVKPPPEEQQMRMHARVSRARHERRHSDVALPRTEAGTALPESKAGKRAPAAARAS
PPESPRAYSAERTAEARAPGAKQLTNHSPPAPRHGPVPAEALEPKAQEPLRKQSRLDPSS
AVLIRKSKREKVETMLRNDSLSSDQSESVRPSPPKPHRSKRGGKKRQMSVSSSEEEGVST
PEYTSCEDVELESESVSEKGDLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGRV
ILNKRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAVQGDEVLE
WNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQK
MERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPTRVDGRPR
NPYVKMYFLPDRSDKSKRRTKTVKKVLEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRV
QEEESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKL
QRSQRISDSDISDYEVDDGIGVVPPVGYRSSARESKSTTLTVPEQQRTTHHRSRSVSPHR
GDDQGRPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRSRDVDSQYLSEQDS
ELLMLPRAKRGRSAECLHTTRHFGRHYKTLPPKMPLLENCSHWNIYSSILPAHTKTKSVT
RQDFPFHHECFHSRVLRFTDEILVSELQPSLDRARSASTNCLRPDTSLHSPERESLVHWA
NRGRWSPSLDRRRPPSPRIQIQHASPENDRHSRKSERSSIQKQTRKGTASDAERVLPPCL
SRRGYAALRATDQPVLRGKHPARSRSSEHSSVRTLCSTHHLAPGGSAPPSPLLTRMHRQA
SPTHPPADTPFSNRRGRQLPQVPVRSGSIEQASLVVEERTRQMKMKVHRFKQTTGSGSSQ
ELDREQYSKYNIHKDQYRSCDNVSAKSSDSDVSDVSAISRTSSASRLSSTSFMSEQSEHP
RGRIRYSSFTPKMQGRRMGTSGRAIMKSTSVSGEMYTLEHNDGSQSDTAVGTVGAGGKKR
RSSLSARVVAIVSRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSREST
DGSINSYSSEGNLIFPGVRLGADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKK
GQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLVF
DESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLT
PLTRRASQSSLESSTGPPCIRS
Download sequence
Identical sequences M3Y4H0
ENSMPUP00000006221 ENSMPUP00000006221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]