SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006254 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006254
Domain Number 1 Region: 234-320
Classification Level Classification E-value
Superfamily SH2 domain 1.06e-48
Family SH2 domain 0.00000963
Further Details:      
 
Domain Number 2 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.88e-38
Family N-terminal domain of cbl (N-cbl) 0.00038
Further Details:      
 
Domain Number 3 Region: 148-233
Classification Level Classification E-value
Superfamily EF-hand 2.96e-36
Family EF-hand modules in multidomain proteins 0.00013
Further Details:      
 
Domain Number 4 Region: 327-401
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-35
Family RING finger domain, C3HC4 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006254   Gene: ENSMPUG00000006308   Transcript: ENSMPUT00000006363
Sequence length 516
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:4758291:4775837:-1 gene:ENSMPUG00000006308 transcript:ENSMPUT00000006363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAADPWGWPSGEARALGRAVRRLQRLEGQCGDPRLASSPPSLRDLLPRIVQLLRQVAH
ARRAAGGGGPEGPGGARDFLIVHLHNLEAKSRQVAALLPPRGERTANDELFREGSRLRRQ
LAKLALIFSYMHAELGALFPKGEYCGHTYQPTKAQAHAFWREHCGARCVLPWAEFESLLC
TCHPVESGSTALALRSTINLTCSGHVSIFEFDIFTRLFQPWPTLLRNWQLLAVNHPGYMA
FLTYDEVQERLQTCRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPLNKPLFQALLD
GQKEGFYLYPDGKNHNPDLTELYQTKPHPYIRVSEEQLQLYWAMDSTFELCKICAESVKD
VKIEPCGHLLCSRCLAAWRHSDSQTCPFCRREIKGQEAVSIQFQVRPAEARATAEHLRDS
SDQEDEEEELGQVVSSAPPQPPQLSVSPAKGRLKVAPLALPRLPGPLSFPRIKTEAPLAL
PRLQGPLSFPRIKTVELAPWQITSSPQAREEAPGNT
Download sequence
Identical sequences M3Y4K3
ENSMPUP00000006254 ENSMPUP00000006254 XP_012919527.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]