SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006287 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006287
Domain Number 1 Region: 126-401
Classification Level Classification E-value
Superfamily Caspase-like 2.54e-80
Family Caspase catalytic domain 0.0000000726
Further Details:      
 
Domain Number 2 Region: 3-88
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-22
Family Caspase recruitment domain, CARD 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006287   Gene: ENSMPUG00000006341   Transcript: ENSMPUT00000006396
Sequence length 402
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897004.1:4495935:4515636:1 gene:ENSMPUG00000006341 transcript:ENSMPUT00000006396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKILKDRRRLFVSSVSPGTLSSLLDELLDQKVLNQEEMERVRCENATTTDKARALIDS
IIRKGPQACQILIAFICAEDSFLAEKLKLSGPPSGSQLNTDSGVATLPAPAFEDTVQLLG
PCEPEEPPNTLKLCPHEEFMKLSKKEAAEIYPIMERNDRTRLALIICNIEFDHLPPRNGA
ETDIAGMKNLLEGLGYSVDVKQKLTAEGMESELRAFASRPEHKSSDSTFLVLMSHGILSG
ICGTAFSPENQDVLPYDTVFQIFNNINCHNLRDKPKVIIIQACRGENLGEAWVSDSKAAS
ADSFSHQPLLLESDAIHRVHVEKDFVAFCSSTPHNVSWRHVTKGSLFIAQLITCFQKYSW
CNHLIEVFQKVQQSFEKPDVKAQMPTIERSSLTRPFYLFPGN
Download sequence
Identical sequences M3Y4N6
ENSMPUP00000006287 XP_004764503.1.14098 ENSMPUP00000006287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]