SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006315 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006315
Domain Number 1 Region: 323-400
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-22
Family Intermediate filament protein, coiled coil region 0.00061
Further Details:      
 
Domain Number 2 Region: 94-127
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000023
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000006315
Domain Number - Region: 96-270
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006315   Gene: ENSMPUG00000006369   Transcript: ENSMPUT00000006424
Sequence length 445
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2023609:2027313:-1 gene:ENSMPUG00000006369 transcript:ENSMPUT00000006424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPGLSSYSPNSMSFTTHSTFSSNYRSLGSMQSPSHRVRPVSSAASVYAGAGGSGSRISVS
RSTSFRGGWGSGGLATGLTAGMARGLAGIGGMQGEKETMQDLNDRLASYLERVRSLEADN
QRLEVRIREHLEKKGPQVRDWGHYFKTIEELRSQIFASSVDNARIVLQIDNARLAADDFR
VKYETELAMRQSVESDIHGLRKVIDDTNVTRLQLETEIEALKEELLFMKKNHEEEVKGLQ
NQIANSGLTVELDAPKSQDLSKIMADIRAQYDELARKNREELDKYWSQQIEESTTVITTQ
TSEIGEAEMTLTELRRTAQSLEINLDSMRNLKASLENSLREVETRYAMQMEQLNGVLLHL
ESELSQTRAEGQRQAQEYEALLNVKVKLEAEIATYRRLLEDGEDFNLSDALDSSSSMQTI
QKTTTRKIVDGKVVSETNDTKVLRR
Download sequence
Identical sequences M3Y4R4
ENSMPUP00000006315 ENSMPUP00000006315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]