SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006389 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006389
Domain Number 1 Region: 262-438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-52
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 22-82
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000336
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006389   Gene: ENSMPUG00000006444   Transcript: ENSMPUT00000006500
Sequence length 445
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:4571117:4595581:-1 gene:ENSMPUG00000006444 transcript:ENSMPUT00000006500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGARSETPGGPGPPEREDASGWRCPEHGDRVAELYCRRCRRCVCALCPVLGAHRGHP
VGLALEEAVHVQKLIQECLKQLETKKQQNVGNITHIEDTAEKLKAHAESSKTWLMGKFTE
LRLLLDEEEALAKKFIDKNTQLTLQAYRQHIESCKEQIDGMHSLSTRVWRISQEPDPIQL
LQEYRAAEQEMQRQTSLGEVCYPTPLSFEPVKSFFQGFVDAMQSLLQTPLDTRLKENTNC
QLSGSSSTKLASLLKTSPSPERSLFLKYARTPTLEPDTMHARLRLSADRLTVRCGLMGRL
GPTPALRFDKLWQVLCRDCYAAGRHYWEVDVQEAGVGWWVGVAYASLRRCGASASARLGC
NRQSWCLKRYDLEYWAFHDGQRSRLRPRDDPDRLGVFLDYEAGILSFYDVSGGMSHLHTF
RAAFQEPLYPALRLWEGAISISRLP
Download sequence
Identical sequences M3Y4Y8
ENSMPUP00000006389 ENSMPUP00000006389 XP_004747732.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]