SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006399 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006399
Domain Number 1 Region: 668-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.96e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 612-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 780-836
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 724-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.74e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 557-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 825-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 96-146
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 9 Region: 407-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-18
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 501-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006399   Gene: ENSMPUG00000006454   Transcript: ENSMPUT00000006510
Sequence length 884
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:5033982:5053646:1 gene:ENSMPUG00000006454 transcript:ENSMPUT00000006510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTNQAVEREGGGRSFPLSPGSHPNTPRQSLENLKSEGGLDLLLLRLGKIRGEMKSLPPW
ENLGEMTMETWTSRPGERALRSQASALSQDGEDKTEFQEPLTFRDVAVVFTEEELRLLDP
AQRKLYRDVMLENFRNLLSVGDKNTKEMEYIPERELKGHYLREVSCWKIWEQVAGELIGS
WDHRGNLQGRSFQFSEDTSHCQGWEGAPARGPHIDNLVGSLQGPIGSENRVFPPWKAVRV
VPAQDSWMKAFVNEPWNIRERCKKLDRQDIIYKHEGDGYGFGWISHHDDHRLPETERPCD
CSQCGKDRIKKLVLHHRPNPPEHDWTRNEHGNGFREESCVPTDPRGPWRERSHKNELGSG
LRPTAHLERPQRPPSVEKASKSPERGWGPRQNTRGPRRARAPAGEMPYRCDVCGKGFRYQ
SILLIHQGVHTGRKPYVCEECGKAFGRSSNLLVHQRVHTGEKPYKCTECGKGFSYSSVLQ
VHQRLHTGEKPYACGECGKGFYARSALHKHQHAHPGERPYSCGQCGKGFACSSHLSSHQK
AHATQKPYQCDKCGKGFSYNSYLQAHQRVHTGQRLFECDVCGKTFSYSSGLLRHQRLHTG
EKPYKCECGKGFGRSSDLHVHQRVHTGEKPYKCGECGKGFRRNSDLHSHQRVHTGERPFV
CGACGKGFIYSSDLLIHQRTHTGEKPYKCAECGKGFSYSSGLLIHQRVHTGEKPYRCTEC
GKGFRCTSSLYKHQRIHTGKKPYTCDQCGKGFSYGSNLRTHQRLHTGEKPYTCYECGKGF
RYGSGLLSHKRVHTGEKPYRCDVCGKGYSQSSHLQGHQRVHTGEKPYRCGECGKGFGRSS
CLHVHQRVHTGEKPYKCGECGKGFSYSSGLRNHQRVHSSEKPDK
Download sequence
Identical sequences M3Y4Z8
XP_012919490.1.14098 ENSMPUP00000006399 ENSMPUP00000006399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]