SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006624 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006624
Domain Number 1 Region: 636-662,697-850
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.87e-37
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 83-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.35e-35
Family Laminin G-like module 0.0099
Further Details:      
 
Domain Number 3 Region: 250-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-34
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 4 Region: 881-1087
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-27
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 5 Region: 2-91
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.91e-26
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.001
Further Details:      
 
Domain Number 6 Region: 490-548
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000012
Family Fibrinogen C-terminal domain-like 0.0052
Further Details:      
 
Domain Number 7 Region: 462-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000706
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006624   Gene: ENSMPUG00000006678   Transcript: ENSMPUT00000006737
Sequence length 1226
Comment pep:novel scaffold:MusPutFur1.0:GL897195.1:423833:555566:-1 gene:ENSMPUG00000006678 transcript:ENSMPUT00000006737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTAVATQGGYGSSYWVTSYVLMFSDGGRNWKQYRREESVSGFPGNTNADSVVHYRLQP
PLEARFLRFLPLAWSPKGRIGMRMEVYGCTYRSKMVNFDGKSSLLYTLNQKSMSPAKDVI
SLKFKTRQTDGILLHREGQNGKHVTLQLVRGKLILLLNSGCANLPSPDAHVTLTLGSLLD
DEHWHSVLIELGNTHVRFTVDRHSQHFQAEGECDYLDLDYKISFGGIPGHGKSVAFPQKD
FHGCFENLYYNGVDLIDLSKKHTPQILVMGNVSFSCSHPQTVPVTFLSSRSYLALPGTVG
EDKVSVTFQFRTWNRAGLLLTTQFQHGPVALVLVLNDGKLRLSLSQPGHTARDVTAGAGL
SDGQWHSVSLSLKGNDLSVMVDGEAASVAHSLRGQIDSGDTYYLGGCPDRSSGPGCGGPL
AGFQGCLRLISIGDKAVDPITVQQGSLGTFRDLQIDTCGLTDRCLPSYCEHGGECSQSWD
TFSCDCAYTGYTGATCHSSLFEQSCDAHRHRGDSSGFYYIDSDGSGPLGPALVYCNVTED
TTWTSVQHNGSQLAKVKSLNGESPQPLFFKYTASPDQLQAIMDGADDCRQELVLHCKKSR
LSTSRDGTPVSWWIGRTNETHTYWGGSLPGVQKCACGLQGNCLDSQYHCNCAAARNEWTS
DTVVLSHKEHLPVTQVVMRDTGRPHSEAAYVLGPLLCSGDNSFWNSASFNTETSYLHFPT
FRGELSADLSFFFKTTAPSGVFIENLGITDFIRLELHAPTEVTFSFDVGNGRCEVTVRSP
TPFNDNRWHHVRAERNVKEATLQVDQLPSKTQAAPADGHARLQLNSQLFVGGTATRQRGF
LGCIRSLRLNGLALDLEERATMTPGVDPGCRGHCSSYGHLCRNGGRCRERPRGIICDCAF
SAYDGPFCESEISAYFGTGSSIIYDFQEHSNYTSSKNSSSFAALLHEGLTLAGEVATLSF
RTTGTPSLLLYVSSFYEEYLSVILTPNGSLQIRYKLDRHQEPDVFNFGFKNFADGRLHQV
TIHREEVVVSVEVDQSARRQVVLSSGAEFNAVKSLMLGTILEPPGADPDTLRAGVRGFTG
CLSAVRFGPAAPLKAALRPSGPVVVTVRGHVATASRCAESVGPGAPAREATRPLAGGAGG
SGPADGGEPLVSADRSGPAVIGGVIAVVVFVLLCLTAIAARIYQQRWLYQKNGSTVPPAG
DSAETALKSEVNVQSSVSESQREYFF
Download sequence
Identical sequences M3Y5M3
ENSMPUP00000006624 ENSMPUP00000006624 XP_012904758.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]