SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006868 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006868
Domain Number 1 Region: 29-124
Classification Level Classification E-value
Superfamily Snake toxin-like 4.85e-24
Family Extracellular domain of cell surface receptors 0.028
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000243
Family Extracellular domain of cell surface receptors 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006868   Gene: ENSMPUG00000006923   Transcript: ENSMPUT00000006982
Sequence length 344
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:5780406:5784433:1 gene:ENSMPUG00000006923 transcript:ENSMPUT00000006982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPARKAGAQAVIRTTGWLVLLMLLLGGGAQALECYSCVQKADDGCSPQKTKTVKCAPGV
KVCTEAVGAVETIHGQFSVAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCSQDRCNTKLN
LTSRALNPAGNESAYQPNGAECYSCVGLSREACQGTAPPVVSCYNASDRVYKGCFDGNVT
LTAANVTVSLPVRGCVQDEFCTRDVVTGPGFTLSGSCCQGSRCNSDLHNKTFFSPRIPPL
VLLPAPKPTTLATTTSVTTTPAPTTLVSTSKPTSAPASQTSPQGVHPETSQKGESSVAEG
APGHQDRSNMGHHPTKGVAYSKGSVTPFIGLVAPLLAVAAGNLL
Download sequence
Identical sequences M3Y6B7
XP_004767766.1.14098 ENSMPUP00000006868 ENSMPUP00000006868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]