SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006916 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006916
Domain Number 1 Region: 176-450
Classification Level Classification E-value
Superfamily Caspase-like 8.97e-83
Family Caspase catalytic domain 0.000000000317
Further Details:      
 
Domain Number 2 Region: 32-123
Classification Level Classification E-value
Superfamily DEATH domain 3.96e-21
Family Caspase recruitment domain, CARD 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006916   Gene: ENSMPUG00000006971   Transcript: ENSMPUT00000007030
Sequence length 452
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897067.1:13498:30649:1 gene:ENSMPUG00000006971 transcript:ENSMPUT00000007030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSTGSRPALQRKALMAADRGRRILGVCGMHPDHQEALKKNRVVLAKQLLLSELLEHL
LERDIITLEMREHIQGKVGSFSQNVELLNLLPKRGPHAFDAFCVALRETKQGHLEDLLLT
TLSGLQHARPPLSCDYDLSLPFPMCESCPPHKQLRLSPDTVEHSLDHGDGPPCLQVKPCT
PEFYQTHYQLAYRLQSQPRGLALVLSNVHFTGEKDLEFRSGGDVDHSTLVTLFKLLGYKV
HVLLDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGGIYGVDGKLLQLQEVFRLF
DNASCPNLQNKPKMFFIQACRGDETDRGVDQRDGKNHTGSSECEESDASKEEMLKARLPT
RSDMICGYACLRGTAAMRNTKRGSWYIEALTQVFSERACDMHVADMLVKVNALIKEREGY
APGTEFHRCKEMSEYCSTLCRPLYLFPGHPPT
Download sequence
Identical sequences M3Y6G5
ENSMPUP00000006916 XP_004772113.1.14098 ENSMPUP00000006916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]