SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007086 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007086
Domain Number 1 Region: 661-726
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-21
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 2 Region: 491-554
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-20
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 3 Region: 558-642
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-20
Family SH3-domain 0.00089
Further Details:      
 
Domain Number 4 Region: 746-788
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000171
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 5 Region: 399-486
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000021
Family SH3-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007086   Gene: ENSMPUG00000007143   Transcript: ENSMPUT00000007204
Sequence length 790
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896960.1:6632831:6768217:-1 gene:ENSMPUG00000007143 transcript:ENSMPUT00000007204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMNTERSQNSVVSRIKAFEGQTNKETSGPPVKPEITPRTLPPRPALPSGKPLVAPKPA
ANRASGEWDSWTENRLKVAPREGLTPQSPPQEVGSIPVTKPELPKKPNAGLTRSINHEIL
GGGPMAESPDGGKKVPTPAPRPLLPKKSVSLEIPNSTALLKPVTVPPRLSVASQAKAFRS
LGEGPPAVSLAASQQSKPPGDIDLISFDDDVLPTPAGNLVEESLGSEMVLVDPFQLPIKT
EPTKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPIEKPIGNTCSTVSGKLSTVD
RIRNLESDHTGQTGGSVRGPPRLPPRPVNGKAIPARQPPHRGAPERPPPPKLSASRASSK
KLPFNRSSSDMDLQKKQSNLASGLSKAKSQVFRTQDPVLPPRPKPGHPLYRKYMLSVPHG
IANEDIVSQNPGELSCKRGDVLVMLKQAENNYLECQKGEDTGRVHLSQIKIITPLDEHLR
SRPNDPNHAQKPVDSSAPHAVVLHDFPAEQADDLHLTSGEIVYLLEKIDPDWYRGRCRNQ
TGIFPANYVRVMVDVPEGGNGKRESVSSHCVKGPRCVARFEYIGDQKDELSFSEGEIIIL
KEYVSEEWARGELRDRIGIFPLNFVELVEDHPISGTNVFSTKVPPKTKKEDSGANSQDTS
LSGEWCEALHSFTAETSDDLSFRRGDRILILERVDADWYKGRLRDREGIFPAVFVRPCPG
TATAEMTVSLQGEPETFRSGFLVSSQQRLSFKAGDIITELESVDDDWMSGELMGKSGIFP
KNYVQFLQVS
Download sequence
Identical sequences M3Y6Y3
ENSMPUP00000007086 ENSMPUP00000007086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]