SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007202 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007202
Domain Number 1 Region: 777-849
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000204
Family SH3-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007202   Gene: ENSMPUG00000007259   Transcript: ENSMPUT00000007321
Sequence length 858
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896928.1:8246382:8366193:-1 gene:ENSMPUG00000007259 transcript:ENSMPUT00000007321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECGRCPASAGKAPVPREGGAAPQVGQVGHLSSGVSRALGGDCSLASANKPKRTLGPRIQ
LWETAFVSQTLPRRKAMEGAIASPADSTYREGLRNFKELRAKFQKFDMPLPPGPIKFSAG
VSQKGNIGNTQSTRILANGKSLSSSHSLLPLCSSAESQLLKDQETKLAQRSEIQKCSNSP
GPLERSSGPAVNSQKSSPLLDRNPSNAEITNKRRVTMNESFKDKLWNWEKFSSQKSESSS
ASLLARCACRICHAEEQKSRGLLPKEPRIMLEIKGTQTLPSQRHLVAQRESLTFPEDPTF
LLFQHGKKNLENPLPEKSPVRGSCQLVYESELSSQAPDSEKQSVDKHQQLLKTKPLPSIE
SLGPPPPKPPKPPVVNLQAFQKQAATISKTHTEAAVEEGCLPPESAEFEEPHNYEATISY
LKHSGNSINLCTAKEIADSTYEVEIEEPQKPRKNGLHQELSPKYEDEDEDKKEKEKEPCE
LEPQKPQKDLPSSHLFKYSLIRSALEVFLHPVSQPRERTSPPPFLSQRTTQLQTALATWY
LKGATRGGMLGRKQVMKVLGGRRSMLPRKQGPVSDATQTKACLQDPKLARHSLGHCGYVE
TLEDTTEMPDGGACKPHSNSEETYDDVEYPGRAGPQSDLSNSFASDNEENNEEMYEEVYK
TKSNYPKIDLDGKEALKRLRKFFKKEKDRFKMKKNKLKENVSAFSISLPDLELRSQEAII
YDNVDISEKESRDENKLKTWKPKFLMAKEKKERKGAEESERNFFRTKKQNLEKMRMEKEE
KRFREQFEYDKEITVINTAVACSSNSRNGIFDLPITPGEELQVIDTTEENLVICRNSKGK
YGYVLIEHLDFKHQGWSP
Download sequence
Identical sequences M3Y795
ENSMPUP00000007202 ENSMPUP00000007202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]