SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007368 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007368
Domain Number 1 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.61e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.84e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 479-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 227-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 363-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-17
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007368   Gene: ENSMPUG00000007424   Transcript: ENSMPUT00000007488
Sequence length 563
Comment pep:novel scaffold:MusPutFur1.0:GL897008.1:2148834:2185122:-1 gene:ENSMPUG00000007424 transcript:ENSMPUT00000007488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQVTFSDVAIDFSYEEWGWLDSAQRDLYKDVMVQNYENLVSLGLSIPKPYVITLLEDGK
EPWMVEKKDWESRWENKELVTKEDIYDEDSPQMEIIKKKIKHSHEFSNFNKDWEYIEKTE
EKHENQVEHFRPVTLTFREGPTGENVYNYKTLSSIFSLKSILSEPQRISAEGKSRKHDIC
KKSLPKESVIKNEEINGGKKLLDSKGSVSAFSQSKSLTLNQTSNREKIYTCNECGKAFGK
QSILNRHWRIHTGEKPYECHECGKTFSHGSSLTRHQISHSGEKPYKCIECGKAFSHVSSL
TNHQRTHTGEKPYECMNCGKSFSRVSHLIEHLRIHTQEKLYECRICEKAFIHRSSLIHHQ
KTHTGEKPYECSECGKAFCCSSHLTRHQRIHTIEKQFECSKCLKVFSSLSFLIQHQSIHN
EEKPFECQKCRKSFNQPESLNMHLRNHTRLKPYECNICGKAFSHRSSLLQHHRIHTGEKP
YECIKCGKTFSCSSNLTVHQRIHTGEKPYKCNECGKAFSKGSNLTAHQRIHNGEKPSSAI
SVEKPLGHMNDYTCEKSHERETI
Download sequence
Identical sequences M3Y7R1
ENSMPUP00000007368 ENSMPUP00000007368 XP_004765234.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]