SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007400 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007400
Domain Number 1 Region: 125-196
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000798
Family LIM domain 0.011
Further Details:      
 
Domain Number 2 Region: 93-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000246
Family LIM domain 0.0087
Further Details:      
 
Domain Number 3 Region: 11-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000132
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007400
Domain Number - Region: 193-226
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0328
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007400   Gene: ENSMPUG00000007456   Transcript: ENSMPUT00000007520
Sequence length 240
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897008.1:2214810:2239440:-1 gene:ENSMPUG00000007456 transcript:ENSMPUT00000007520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLYHTDCFTCDSCGRRLRGKAFYNVGENVYCQEDFLVSRSWVLATVGESRGGDPPAPC
GDLGPGGRCWLGSEGPFVTGHSGSSVPSQYSGFQQTAEKCSVCGHLIMEMILQALGKSYH
PGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVV
SMDRDYHVECYHCEDCGLQLSGEDGRRCYPLEGHLLCRRCHLRRLRPGPLPSPAVHVTEL
Download sequence
Identical sequences M3Y7U3
ENSMPUP00000007400 ENSMPUP00000007400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]