SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007413 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007413
Domain Number 1 Region: 134-171,251-296
Classification Level Classification E-value
Superfamily SET domain 0.000000693
Family Histone lysine methyltransferases 0.061
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007413
Domain Number - Region: 129-242
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0973
Family Galacturonase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007413   Gene: ENSMPUG00000007469   Transcript: ENSMPUT00000007533
Sequence length 299
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:5607381:5613944:-1 gene:ENSMPUG00000007469 transcript:ENSMPUT00000007533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRLLRGLRQRWRRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLGTLLKVF
QALFINDFNKQSDILTMLPETVKSKYHNLLSVQHPRVKLLEYRHQQQNTFKPEEILYKTL
GFSVARETSSLISAGKGVFVTRGWVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLD
GVLIDGNDKGISKVVYRSCNGRDRLGPFKMSDSTWLTSEICNPLAVGQYVNNCSNDRAAN
VCYQEFDVPAVFPIELKQYLPNIAYSCDKQSPLRCVILVALRDIKQGEELFSNYYTIVS
Download sequence
Identical sequences M3Y7V6
XP_004744691.1.14098 ENSMPUP00000007413 ENSMPUP00000007413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]