SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007473 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007473
Domain Number 1 Region: 195-353
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-26
Family SPRY domain 0.00057
Further Details:      
 
Domain Number 2 Region: 54-123
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000757
Family RING finger domain, C3HC4 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007473   Gene: ENSMPUG00000007529   Transcript: ENSMPUT00000007593
Sequence length 356
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897339.1:82724:87037:-1 gene:ENSMPUG00000007529 transcript:ENSMPUT00000007593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVHAPAGERVPQSASSRRGSPSARWEAAAGVAEGWAPGRALPMEAPELGPGLVERLEQLA
TCPLCGGPFEDPVLLACEHSFCRACLARCWGAPPAAGAPAPPTACPCCGQPCPRRSLRSN
VRLAVEVRISRGLREKLAEPGARAGRRRGGRIPTMGCLDPHGEDIRKTWRRLDAPRPKSS
NSDDDLPEDYPVVKNMLHRLTADLTLDPGTAHRRLLISADRRSVRLAPPGTPAPPDGPAR
FDQLPAVLGAQGFGAGRHCWEVETAEAASGPDSSGEDEDDNESRYAVGAAGESVRRKGRV
GLCDLDWERGRVAFYDGRSLDLLFAFQAPGPLGERVFPLLCTRDARAPLRIVPAEG
Download sequence
Identical sequences M3Y816
ENSMPUP00000007473 ENSMPUP00000007473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]