SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007478 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007478
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000341
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007478   Gene: ENSMPUG00000007534   Transcript: ENSMPUT00000007598
Sequence length 327
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:6233242:6252571:-1 gene:ENSMPUG00000007534 transcript:ENSMPUT00000007598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSGLTPAPSWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLA
RARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYNYGTS
SSSSKRTEGSRRRHRQSSGTSDAQQGQWETGSPPTKRQRRSRGRPSGGARRRRRGTAAAP
QQPQETSRPASEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQATAVL
RSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLLVSV
DEADYEAGRRRLLLMEEEGGRRPTEAS
Download sequence
Identical sequences M3Y821
ENSMPUP00000007478 ENSMPUP00000007478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]